DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33642

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:189 Identity:50/189 - (26%)
Similarity:76/189 - (40%) Gaps:45/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLTELFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVK---RDVVE----MSLR 58
            :||.| ||.|  ||          |||..||..:|....:.: ..:|||   ||:::    ..:.
  Fly     4 LATST-LFWL--LW----------FTNHICLKCEERSFRIKM-NEFAVKYKMRDLIQHIDFRIVN 54

  Fly    59 ANILRWPKGPVSMR-----------MQLLKKASGYKPFLYNICQSDVCEYLE--KRNHPFINIIL 110
            .|...:..|.:.::           |...|.::..|..||: .:.|.|::|:  .||..| .|.:
  Fly    55 LNNRSYVNGEMIVKSDVEDILMHTTMDFWKTSNQKKIKLYD-GRLDACQFLKTSHRNGLF-KIYV 117

  Fly   111 SSFGNRTNVN-KCPIPPEI--VLEHFRFPVKVLDMMPLPFGDYGLFTTFT--FHRSELA 164
            .||....:.| .||:....  .|.::....|.|.    ||...|.|.|.|  |.:..||
  Fly   118 KSFKKHIHGNLSCPLRTNFNYTLTNWHMDEKDLP----PFVPLGTFRTVTEYFTQDRLA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 27/90 (30%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 23/86 (27%)

Return to query results.
Submit another query.