DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33137

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:154 Identity:38/154 - (24%)
Similarity:75/154 - (48%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAV--KRDVVEMSLRANILRWPKGPVSMR 72
            ::.::.:.:...|.|..|||| |....|:..:.|.:.|:  .:.|.||.:  .:|| |...:::|
  Fly     1 MYDIFQLSEPNIVYKLKNIEC-STVPGFSANASCHIRAINWNKAVAEMDV--YLLR-PLYNITIR 61

  Fly    73 MQLLKK--ASGYKPFLYNICQSDVCEYLEKRNH-PFINIILSSFGNRTNVN-KCP---------- 123
            .|:|||  ::.::|||.::. .::|:.|.:|:. |:..|||......:|.| .||          
  Fly    62 FQILKKDYSNKFQPFLVDVV-INMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGA 125

  Fly   124 ------IPPEIVLEHFRFPVKVLD 141
                  :|....|..::|.:.:::
  Fly   126 YLNESYLPNVFPLGFYKFNITIME 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 17/78 (22%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.