DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33453

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:174 Identity:56/174 - (32%)
Similarity:93/174 - (53%) Gaps:15/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTELFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGP 68
            |..|||:..:.....:    |.||:.|.|.::::.....|||.|..|:...:::.|..|. |...
  Fly    12 LAALFLISSVSEAPNI----KLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNN 71

  Fly    69 VSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEH 132
            ||:|::::|:.|||||||::: ..|.|::|.||::|.|.:..|...:.:.:| .||...::|.::
  Fly    72 VSLRLKMVKRLSGYKPFLFDV-TIDACQFLRKRHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSDY 135

  Fly   133 FR--FPVKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLTE 174
            ..  |||      |||.||||:...|.|:..:...|.:||...|
  Fly   136 HTAVFPV------PLPSGDYGVLLDFIFYAKKQFHVNIYFNFVE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 32/93 (34%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471952
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.