DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33454

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:130 Identity:48/130 - (36%)
Similarity:73/130 - (56%) Gaps:7/130 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFL 86
            :.|.||:.|.|.|::.|....|||.|..|....:.:.|..|. |...:|:|.|:||:|:||||||
  Fly    24 MVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLH-PINSISVRFQMLKRANGYKPFL 87

  Fly    87 YNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPVKVLDMMPLPFGDY 150
            ::| ..|.|::|.|.|:|.|.|:.:...:.:|:| .||. ..:||..|.   ::...:|.|.|||
  Fly    88 FDI-TVDACQFLRKPNNPVIKIVYNMIKDASNINHSCPY-GTVVLNDFH---RISLPLPFPSGDY 147

  Fly   151  150
              Fly   148  147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/70 (37%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471948
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.