DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33463

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster


Alignment Length:169 Identity:49/169 - (28%)
Similarity:84/169 - (49%) Gaps:24/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TELFLLFGLWHILQV----QGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWP 65
            |:|.||..||..:|:    ..:.:|.||.|.:.|:.|:....|.|.:|.|....:|::..:|:.|
  Fly     3 TKLSLLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLP 67

  Fly    66 KGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRNH-PFINIILSSFGNRTNVN-KCPIPPEI 128
            .....:...|.::.:||||||||| ..|.|:.::...: |..:....:|...:|:| .||...:|
  Fly    68 VTNAKVNGALFQRHNGYKPFLYNI-TVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDI 131

  Fly   129 VLE--------HFRFPVKVLDMMPLPFGDYGL----FTT 155
            :|:        |     ::.:::|.|.|||.|    ||:
  Fly   132 ILDKLTAKSVYH-----RMTNILPFPEGDYMLQLNWFTS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 27/88 (31%)
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 26/90 (29%)

Return to query results.
Submit another query.