DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33483

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:164 Identity:50/164 - (30%)
Similarity:83/164 - (50%) Gaps:10/164 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASG 81
            :::..:.:||||:|.|.|:.|.....|.|.:|.|....:||:.|:.:.|...|.:...|||:.:|
  Fly    69 VKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNG 133

  Fly    82 YKPFLYNICQSDVCEYL-EKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPV-----KV 139
            |||||||| ..|.|:.| ..:.:|..:.....|.:.:|:| .||...::::|  :.|.     ||
  Fly   134 YKPFLYNI-TVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVE--KLPTNFMNQKV 195

  Fly   140 LDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173
            ...:..|.|||...:.:..:....|.|..:.||:
  Fly   196 NGDIKFPHGDYLFHSDWYAYGINRATVDFFLTLS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 28/97 (29%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472347
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.