DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SKP1

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_010615.3 Gene:SKP1 / 851928 SGDID:S000002736 Length:194 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:32/101 - (31%)
Similarity:53/101 - (52%) Gaps:10/101 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDEDFVLPLHGIHSNVLLKILLWAEYHEKHEEPAW--VDSKDPLPAEEIELQISDWDKEFLRVEI 98
            :|::.|:|:..:.|:||.|::.|||:|.....|..  .||:...|       :..||:|||:|:.
Yeast    71 DDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAP-------VDSWDREFLKVDQ 128

  Fly    99 DSICKIMEGCNYLDI-PWLYKLCAQKLVFLSSREPE 133
            :.:.:|:...|||:| |.|...|......:..|.||
Yeast   129 EMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 25/78 (32%)
SKP1NP_010615.3 SKP1 3..194 CDD:227528 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.