DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SKP1

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_565123.1 Gene:SKP1 / 843928 AraportID:AT1G75950 Length:160 Species:Arabidopsis thaliana


Alignment Length:165 Identity:44/165 - (26%)
Similarity:79/165 - (47%) Gaps:31/165 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETRDGRTISVNLALLEKSLVIREMCRVGQVPEDE--DFVLPLHGIHSNVLLKILLWAEYHEKHEE 67
            ::.||.:..|..|:..:|..|..|.      ||:  |..:||..:.|.:|.|::   ||.::|.|
plant     9 KSSDGESFEVEEAVALESQTIAHMV------EDDCVDNGVPLPNVTSKILAKVI---EYCKRHVE 64

  Fly    68 PAWVDSKDPLPAEEIE-LQISD-----WDKEFLRVEIDSICKIMEGCNYLDIPWLYKLCAQKLV- 125
            .|  .||    ||.:| ...||     ||.:|::::..::.:::...|||:|..|..|..|.:. 
plant    65 AA--ASK----AEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVAD 123

  Fly   126 FLSSREPE---TQFSGYVEKIPRFQDHFIEQIQKE 157
            .:..:.||   |.|:...:..|..:    |::::|
plant   124 MIKGKTPEEIRTTFNIKNDFTPEEE----EEVRRE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 33/115 (29%)
SKP1NP_565123.1 BTB_POZ_SKP1 5..125 CDD:349631 37/130 (28%)
Skp1 111..158 CDD:396171 10/48 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.