DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SK12

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_567967.1 Gene:SK12 / 829598 AraportID:AT4G34470 Length:152 Species:Arabidopsis thaliana


Alignment Length:137 Identity:36/137 - (26%)
Similarity:70/137 - (51%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFV---LPLHGIHSNVLLKILLWAEYH 62
            |:...:.||::..|..|:..:|..|..|.       ::|.|   :||..:.|.:|:|::   ||.
plant     5 MIVLMSSDGQSFEVEEAVAIQSQTIAHMV-------EDDCVADGIPLANVESKILVKVI---EYC 59

  Fly    63 EKHEEPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKLCAQKLV-F 126
            :|:.    ||..:|:..|:    ::.||::|:.:|..:|.:::...|||:|..|:.|..|.:. .
plant    60 KKYH----VDEANPISEED----LNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADM 116

  Fly   127 LSSREPE 133
            :..:.||
plant   117 IKGKTPE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 30/114 (26%)
SK12NP_567967.1 Skp1 3..102 CDD:214704 30/114 (26%)
SKP1 5..150 CDD:227528 36/137 (26%)
Skp1 77..150 CDD:279768 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.