DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SK8

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_566692.1 Gene:SK8 / 821737 AraportID:AT3G21830 Length:152 Species:Arabidopsis thaliana


Alignment Length:121 Identity:28/121 - (23%)
Similarity:52/121 - (42%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPLHGIHSNVLLKILLWAEYHEKHE 66
            :..::.:|:|..:......:...|..|...    |..|.|:.:..:.|.:|..::   ||..||.
plant     6 IMLKSSEGKTFEIEEETARQCQTIAHMIEA----ECTDNVILVLKMTSEILEMVI---EYCNKHH 63

  Fly    67 EPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKLCAQ 122
                ||:.:|...:::|    .|||||:..:..:|..:....|:|:...|..|..|
plant    64 ----VDAANPCSDDDLE----KWDKEFMEKDKSTIFALTNAANFLNNKSLLHLAGQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 25/110 (23%)
SK8NP_566692.1 SKP1 3..150 CDD:227528 28/121 (23%)
Skp1 4..101 CDD:214704 24/109 (22%)
Skp1 77..150 CDD:279768 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.