DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SK20

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001078065.1 Gene:SK20 / 819203 AraportID:AT2G45950 Length:352 Species:Arabidopsis thaliana


Alignment Length:157 Identity:27/157 - (17%)
Similarity:65/157 - (41%) Gaps:25/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETRDG--RTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPL-HGIHSNVLLKILLWAEYHEKHE 66
            :|.||  :.:...:|:. ..::.:|:.:.| |...::..:.| ..::..:...||.:..:|:   
plant    21 QTADGSIQQVEQEVAMF-CPMICQEVIQKG-VGSSKNHAISLPQRVNPAMFSLILDYCRFHQ--- 80

  Fly    67 EPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKLCAQKLV-FLSSR 130
                      ||... ..:...:|:.|:|::...:|::....:.|.:..|..|.::.|. .:..:
plant    81 ----------LPGRS-NKERKTYDERFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGK 134

  Fly   131 EPETQFSGYVEKIPRFQDHFIEQIQKE 157
            .||.     :.:|....|...|:.:.|
plant   135 NPEE-----IREIFHLPDDLTEEEKLE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 18/110 (16%)
SK20NP_001078065.1 Skp1 15..116 CDD:214704 18/110 (16%)
Skp1 90..153 CDD:279768 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.