DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and MEO

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_565467.1 Gene:MEO / 816536 AraportID:AT2G20160 Length:150 Species:Arabidopsis thaliana


Alignment Length:104 Identity:27/104 - (25%)
Similarity:54/104 - (51%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VIREMCRVGQVPEDE--DFVLPLHGIHSNVLLKILLWAEYHEKHEEPAWVDSKDPLPAEEIELQI 86
            |.|:|..|..:.:|:  |..:.|..:...:|..|:   ||.:||.:.  |::|:         :.
plant    22 VARKMQMVAHMIDDDCADKAIRLQNVTGKILAIII---EYCKKHVDD--VEAKN---------EF 72

  Fly    87 SDWDKEFLR-VEIDSICKIMEGCNYLDIPWLYKLCAQKL 124
            ..||.||:: :::|::.|:::..:||.:..|..|.||.:
plant    73 VTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAI 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 23/91 (25%)
MEONP_565467.1 BTB_POZ_SKP1 5..114 CDD:349631 27/104 (26%)
Skp1 102..148 CDD:396171 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.