DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SK16

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_565297.1 Gene:SK16 / 814848 AraportID:AT2G03190 Length:170 Species:Arabidopsis thaliana


Alignment Length:135 Identity:36/135 - (26%)
Similarity:62/135 - (45%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DGRTISVNLALLEKSLVIREMCRVGQVPED-EDFVLPLHGIHSNVLLKILLWAEYHEKHEEPAWV 71
            |..:..|..|:..|..||..|     :.:| .|..:||..:..|:|..::   ||.:||......
plant    12 DDESFEVEEAVARKLKVIAHM-----IDDDCADKAIPLENVTGNILALVI---EYCKKHVLDDVD 68

  Fly    72 DSKDPLPA------EEIELQISDWDKEFLR-VEIDSICKIMEGCNYLDIPWLYKLCAQKLV-FLS 128
            ||.|...|      ||.:.::..||.||:: .:::::.|::...|||::..|..|..|.:. .:.
plant    69 DSDDSTEATSENVNEEAKNELRTWDAEFMKEFDMETVMKLILAVNYLNVQDLLGLTCQTVADHMK 133

  Fly   129 SREPE 133
            ...||
plant   134 DMSPE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 31/112 (28%)
SK16NP_565297.1 SKP1 3..165 CDD:227528 36/135 (27%)
Skp1 3..117 CDD:214704 31/112 (28%)
Skp1 92..165 CDD:279768 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.