DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skp1

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001016519.1 Gene:skp1 / 549273 XenbaseID:XB-GENE-919631 Length:163 Species:Xenopus tropicalis


Alignment Length:168 Identity:42/168 - (25%)
Similarity:82/168 - (48%) Gaps:27/168 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRFETRDGRTISVNLALLEKSLVIREMCR-VGQVPEDEDFVLPLHGIHSNVLLKILLWAEYHEKH 65
            ::.::.||....|::.:.::|:.|:.|.. :|...|.:|..:||..:::.:|.|::.|..:|:  
 Frog     4 IKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHK-- 66

  Fly    66 EEPAWVDSKDPLPAEEIELQ------ISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKL-CAQK 123
                    .||.|.|:.|.:      |..||:|||:|:..::.:::...|||||..|..: |...
 Frog    67 --------DDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTV 123

  Fly   124 LVFLSSREPETQFSGYVEKIPRFQDHFIE----QIQKE 157
            ...:..:.||.     :.|....::.|.|    |::||
 Frog   124 ANMIKGKTPEE-----IRKTFNIKNDFTEEEEAQVRKE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 30/117 (26%)
skp1NP_001016519.1 BTB_POZ_SKP1 4..127 CDD:349631 34/132 (26%)
Skp1 113..160 CDD:396171 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.