DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SkpE

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_608359.1 Gene:SkpE / 32997 FlyBaseID:FBgn0031074 Length:167 Species:Drosophila melanogaster


Alignment Length:166 Identity:40/166 - (24%)
Similarity:69/166 - (41%) Gaps:25/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPLHGIHSNVLLKILLWAEYHEKHE 66
            ::.|:.:|......:.:...|..|:.|.....|..||:.::|||.:.:..|.|||.||.:|:.  
  Fly     6 IKLESSEGVIFPTEVRVAMVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKD-- 68

  Fly    67 EPAWVDSKDPLPAEEIE----LQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKLCAQKLV-F 126
                 |.......||::    ..||.||..||.|...::.:|:.....|.|..|.:|....:. .
  Fly    69 -----DDDQSTEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYNVVANM 128

  Fly   127 LSSREPETQFSGYVEKIP-----------RFQDHFI 151
            :..:.||.  ..::..||           |::|.|:
  Fly   129 IRGKTPEE--IRFIFNIPEDVSPSVDGELRWKDLFL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 30/114 (26%)
SkpENP_608359.1 SKP1 3..156 CDD:227528 37/158 (23%)
BTB 6..114 CDD:295341 30/114 (26%)
Skp1 88..156 CDD:279768 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.