DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and SkpD

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_608357.2 Gene:SkpD / 32995 FlyBaseID:FBgn0026174 Length:158 Species:Drosophila melanogaster


Alignment Length:133 Identity:41/133 - (30%)
Similarity:67/133 - (50%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPLHGIHSNVLLKILLWAEYHEKHE 66
            ::.|:.||...|..:...:.|..|:.|..|..|..||:.|:||..:::.:|.|||.|| ||.|.:
  Fly     6 IKLESSDGVIFSTEVKAAKLSETIKTMLEVSAVENDENAVVPLPKVNAFILNKILTWA-YHHKDD 69

  Fly    67 EPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLYKLCAQKLV-FLSSR 130
            :....:.::..|....:  ||.||..|:.|:...:.:|....|||:|..|..||.:.|. .:..:
  Fly    70 DDQAAEGEELTPQSPHD--ISPWDANFINVDQPILFEITVAANYLEIKGLEDLCCKTLANMIRGK 132

  Fly   131 EPE 133
            .||
  Fly   133 TPE 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 34/110 (31%)
SkpDNP_608357.2 Skp1 6..114 CDD:214704 34/110 (31%)
Skp1 88..>147 CDD:279768 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.