DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skr-18

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_741300.1 Gene:skr-18 / 260116 WormBaseID:WBGene00018935 Length:183 Species:Caenorhabditis elegans


Alignment Length:130 Identity:26/130 - (20%)
Similarity:54/130 - (41%) Gaps:30/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRFETRDGRTISVNLALLEKSLVI----------REMC-RVGQVPEDEDFVLPLHGIHSNVLLK 54
            :::..:.:|..:..::..|:.|..|          :|.| .:..:|.||         |...|..
 Worm    28 LLQLASSNGEVLQADIRALQLSSTISTTIKELGYDKEDCAEIKPIPVDE---------HEYTLDL 83

  Fly    55 ILLWAEYHEKHEEPAWVDSKDPLPAE--EIELQISDWDKEFLRV-EIDSICKIMEGCNYLDIPWL 116
            ::.|.:.| |.::|      :...||  :.::.|..||:.|..| .:.::..:::....|||..|
 Worm    84 LIKWCDQH-KGDDP------EIAKAEKGKKKVVIPSWDQHFFSVLPMGNLLAVIKAAYDLDITGL 141

  Fly   117  116
             Worm   142  141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 23/125 (18%)
skr-18NP_741300.1 BTB_POZ 28..153 CDD:365784 26/130 (20%)
Skp1 140..>169 CDD:366656 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.