DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skr-20

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_510192.1 Gene:skr-20 / 181445 WormBaseID:WBGene00004826 Length:173 Species:Caenorhabditis elegans


Alignment Length:88 Identity:22/88 - (25%)
Similarity:38/88 - (43%) Gaps:10/88 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HSNVLLKILLWAEYHEKHEEPAWVDSKDPLPAEEIEL-QISDWDKEFLRVEIDSICKIMEGCNYL 111
            ||:::..::.|. ||.:....|..|||       |.. ..|:|||:|..||...:..::...:.|
 Worm    58 HSSIVQAVIEWL-YHYQDNPLARRDSK-------IRYHDFSEWDKQFFNVESGVLFALLNASHAL 114

  Fly   112 DIPWLYKL-CAQKLVFLSSREPE 133
            .:..|..: ||.....:..:..|
 Worm   115 GVEDLMNMGCAAAAELIRGKSTE 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 18/65 (28%)
skr-20NP_510192.1 Skp1 7..116 CDD:214704 18/65 (28%)
Skp1 90..154 CDD:279768 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.