DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skr-5

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_507393.1 Gene:skr-5 / 180148 WormBaseID:WBGene00004811 Length:145 Species:Caenorhabditis elegans


Alignment Length:108 Identity:29/108 - (26%)
Similarity:53/108 - (49%) Gaps:23/108 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DFV-------LPLHGIHSNVLLKILLWAEYHEKHEEPAWVDSKD-PLPAEEIELQ----ISDWDK 91
            |||       :||..:.|.:..|::.|.|||          ::| |.|.:.:|.:    |.:||.
 Worm    33 DFVVLNQREPIPLKNVTSEIFKKVIEWCEYH----------AEDIPKPPDNVEEKRTDDIGEWDV 87

  Fly    92 EFLRVEIDSICKIMEGCNYLDIPWLYKLCAQKLV-FLSSREPE 133
            |||:|:..::.:::....||||..|:.:..:.:. .:..:.||
 Worm    88 EFLKVDKGTLFELVLAATYLDIKGLFNVTCKSIANSIKGKSPE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 24/85 (28%)
skr-5NP_507393.1 Skp1 5..109 CDD:214704 24/85 (28%)
Skp1 84..>141 CDD:279768 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.