DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skr-7

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_504221.1 Gene:skr-7 / 178840 WormBaseID:WBGene00004813 Length:194 Species:Caenorhabditis elegans


Alignment Length:165 Identity:36/165 - (21%)
Similarity:72/165 - (43%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRFETRDGRTISVNLALLEKSLVIREM---CRVGQVPEDEDFVLPLHGIHSNVLLKILLWAEYH 62
            |.:.|:.||:...::...:::|..:..:   |....|...:.  :|:..:..|::..::.|.|.|
 Worm    22 MYKVESSDGQVYEISDEAVKQSNTLSNLISTCVANDVASMDP--IPITNVTGNIMKMVIEWCEKH 84

  Fly    63 EKHEEPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLY----KLCAQK 123
            :....|.   ..|.:|.   .:.:.:||..||:::.|.:..::...|:||:|.|.    |:.|..
 Worm    85 KGETLPV---EDDSVPK---NITVPEWDTNFLKIDNDVLFDLIVASNFLDVPGLMSYACKMVANM 143

  Fly   124 LVFLSSREPETQFSGYVEKIPR-FQDHFIEQIQKE 157
            .:..|..|....|:     ||. .:|...|:..||
 Worm   144 AIGKSPDEMRVLFA-----IPTDEEDEAAEKAAKE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 22/114 (19%)
skr-7NP_504221.1 Skp1 20..129 CDD:214704 22/114 (19%)
Skp1 103..>160 CDD:279768 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S272
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.