DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skr-10

DIOPT Version :9

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_502902.1 Gene:skr-10 / 178447 WormBaseID:WBGene00004816 Length:192 Species:Caenorhabditis elegans


Alignment Length:167 Identity:42/167 - (25%)
Similarity:76/167 - (45%) Gaps:25/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRFETRDGRTISVNLALLEKSLVIREM---CRVGQVPEDEDFV--LPLHGIHSNVLLKILLWAE 60
            |.:.|:.||....::...:::|..:..:   |    .|||...:  :|:..:..|:|..::.|.|
 Worm    20 MYKVESNDGTVFEISDEAVKQSNTLSNLISTC----APEDVASMDPIPITNVTGNILKMVIEWCE 80

  Fly    61 YHEKHEEPAWVDSKDPLPAEEIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLY----KLCA 121
            .|:....|  ||. |.:|.   .:.:.:||..||:::.:.:..::..|||||:|.|.    |:.|
 Worm    81 KHKGEALP--VDD-DSVPK---HITVPEWDTNFLKIDNEVLFDLIVACNYLDVPGLMNYGCKMVA 139

  Fly   122 QKLVFLSSREPETQFSGYVEKIPR-FQDHFIEQIQKE 157
            ...:..|..|....|:     ||. .:|...|:..||
 Worm   140 MMAIGKSPDELRIIFA-----IPTDEEDEAAERAAKE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB 1..113 CDD:295341 28/116 (24%)
skr-10NP_502902.1 Skp1 18..127 CDD:214704 28/116 (24%)
Skp1 101..>159 CDD:279768 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.