DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and skr-17

DIOPT Version :10

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001379551.1 Gene:skr-17 / 174257 WormBaseID:WBGene00004823 Length:180 Species:Caenorhabditis elegans


Alignment Length:127 Identity:30/127 - (23%)
Similarity:62/127 - (48%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRFETRDGRTISVNL-ALLEKSLVIREMCRVGQVPEDEDFVLPLHGIH-SNVL---LKILL-WA 59
            :::..:.||..:..:: |||..|.:...:..:|.   |:::...|..:. :||:   ||:|: |.
 Worm    24 LLQLTSSDGHLLQGDIRALLLSSTLAATIRELGY---DKEYCAELKPVPVNNVVGFTLKLLIEWC 85

  Fly    60 EYHEKHEEPAWV----DSKDPLPAEEIELQISDWDKEFL-RVEIDSICKIMEGCNYLDIPWL 116
            :.| |.::||..    |.|:        :.|..||:.|| |:.:.::..::....:||:..|
 Worm    86 DKH-KEDDPAIALAEKDKKN--------ICIPSWDRHFLSRLPMSNLFDLITAAYHLDVTGL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB_POZ 1..123 CDD:453885 30/127 (24%)
skr-17NP_001379551.1 BTB_POZ_SKP1 24..150 CDD:349631 30/127 (24%)
Skp1 137..>166 CDD:460222 1/2 (50%)

Return to query results.
Submit another query.