powered by:
Protein Alignment CG15800 and C42D4.18
DIOPT Version :9
Sequence 1: | NP_611828.1 |
Gene: | CG15800 / 37763 |
FlyBaseID: | FBgn0034904 |
Length: | 157 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001255289.1 |
Gene: | C42D4.18 / 13196550 |
WormBaseID: | WBGene00206380 |
Length: | 168 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 34/72 - (47%) |
Gaps: | 19/72 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LEKSLVIREMCRVGQVPEDEDFVLPLHGIHSNVLLKILLWAEYHEKHEEPAWVDSKDPLPAEEIE 83
||:. ||||.| :.|:|:::..:...:. |..:::.|| ..|:.|...:|:
Worm 76 LERK--IREMNR---LKEEEEYMEEVDKRYE---------ARLNKEREE----KMKNGLEIIKID 122
Fly 84 LQISDWD 90
|:.||:
Worm 123 -QLEDWN 128
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15800 | NP_611828.1 |
BTB |
1..113 |
CDD:295341 |
18/72 (25%) |
C42D4.18 | NP_001255289.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5201 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.