DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15800 and gcnt3

DIOPT Version :10

Sequence 1:NP_611828.1 Gene:CG15800 / 37763 FlyBaseID:FBgn0034904 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_004917977.1 Gene:gcnt3 / 100486486 XenbaseID:XB-GENE-5887146 Length:443 Species:Xenopus tropicalis


Alignment Length:149 Identity:31/149 - (20%)
Similarity:52/149 - (34%) Gaps:40/149 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EDEDFVLPLH-GIHSNV-LLKILLWAEYHEKHEEPAWVDSKDP------------------LPAE 80
            |::||.:... .||.|: :.:.||.|.|...:.....:|.|.|                  :.::
 Frog   128 EEQDFPIAYSMVIHDNIEMFERLLRAIYTPHNIYCVHMDKKSPESFHQAVRAITSCFGNVFVASK 192

  Fly    81 EIELQISDWDKEFLRVEIDSICKIMEGCNYLDIPWLY-----------KLCAQKLVFLSSREPET 134
            .:.:..:.|    .||:.|..|  ||......:||.|           |..|:.:..|.|.....
 Frog   193 LVNVVYASW----RRVQADLNC--MEDLLQSKVPWKYLINTCGTDFPIKTNAEMVKALKSLNGHN 251

  Fly   135 QFSGYV---EKIPRFQDHF 150
            .....:   .|..|::.||
 Frog   252 SMESEIPPNHKKRRWEYHF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15800NP_611828.1 BTB_POZ 1..123 CDD:453885 25/117 (21%)
gcnt3XP_004917977.1 Branch 134..404 CDD:452742 28/143 (20%)

Return to query results.
Submit another query.