DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and Adamts4

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_076449.1 Gene:Adamts4 / 66015 RGDID:621242 Length:851 Species:Rattus norvegicus


Alignment Length:519 Identity:123/519 - (23%)
Similarity:195/519 - (37%) Gaps:124/519 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 AFGQHLNLSLRATQGL--------FKG-APHQLRMWTVGSEPNATHGLDLQEIVHEQHTSNDVGE 180
            |||:.|.|.|....|:        :.| ||..|.    |:||    |..|            .|.
  Rat   101 AFGEILLLELEQDPGVQVEGLTVQYLGQAPEMLG----GAEP----GTYL------------TGT 145

  Fly   181 VFQDEKNMAAILMRRHMETGDLIMEGSI---GHDLVIKPLP-HELSPNPEESHHIIYKREASAAE 241
            :..|.:::|::    |.:.|.|:  |.:   |.:|.::||. ..|:.......||:.::..::..
  Rat   146 INGDPESVASL----HWDRGALL--GVLQYRGAELHLQPLEGGALNSAGGPGAHILRRKSPASNR 204

  Fly   242 GQLSDFAFMEPDDLLASEKLERLQRRQRRSRRSAPSSPDFEDLNDEDEGALDGEPQVAESRTRSR 306
            |.:.:.                          .|||                |.|... || |::
  Rat   205 GPICNV--------------------------KAPS----------------GSPSPI-SR-RNK 225

  Fly   307 RQAPYIIYPEVLVIVDYDGYRLHGGDNLQVKRYFISFWNGVDLRYRLLKGPRIR----ISIAGII 367
            |.|....:.|.||:.|......||..   :|.|.::.   :....:..|.|.||    :.:..::
  Rat   226 RFASLSRFVETLVVADDKMAAFHGAG---LKHYLLTV---MAAAAKAFKHPSIRNPVNLVVTRLV 284

  Fly   368 ISRGRDATPYLERNRVGRDAIDSAAALTDMGKYLF--RERRLPVYDIAVAITKLDMCRRTSAYGE 430
            |.......|     :||..|..:..:.....|.|.  .:.....:|.|:..|:.|:|      |.
  Rat   285 ILGSGQEVP-----QVGPSAAQTLRSFCTWQKGLNPPNDSDPDHFDTAILFTRQDLC------GV 338

  Fly   431 CNRGTAGFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLGG 495
            ......|.|.||..|      :...|.||:|| .|......||||:||:...:||.|.|.:.|.|
  Rat   339 STCDALGMAGVGTVC------DPARSCAIVED-DGLQSAFTAAHELGHVFNMLHDNSKPCANLNG 396

  Fly   496 PGAQRCRWEDGYIMSD-LRHTERGFRWSACTVQSFHHFLNGDTATCLHNAPHEDSALGRSLPGTL 559
            .|:     ...::|:. :.|.:....||.|:.:....||:.....||.:.|.....|..:.||..
  Rat   397 QGS-----SSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPVTFPGKD 456

  Fly   560 LSLDAQCRRDRG--TYACFKDERVCAQLFCFDAQTGYCVA---YRPAAEGSACGNGYHCLDGRC 618
            ...|.||:...|  :..|.:....||.|:||....|:.:.   :.|.|:|:.||....|:.|||
  Rat   457 YDADRQCQLTFGPDSSHCPQLPPPCAALWCFGHLNGHAMCQTKHSPWADGTPCGPAQACMGGRC 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 57/235 (24%)
Adamts4NP_076449.1 Pep_M12B_propep 92..195 CDD:279848 29/119 (24%)
Reprolysin 232..442 CDD:279729 58/238 (24%)
ZnMc_ADAMTS_like 232..439 CDD:239801 57/235 (24%)
ADAM_CR 452..523 CDD:301627 22/69 (32%)
TSP1 545..589 CDD:214559
ADAM_spacer1 701..816 CDD:283607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.