DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and wfikkn2b

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_699239.1 Gene:wfikkn2b / 570642 ZFINID:ZDB-GENE-110414-1 Length:563 Species:Danio rerio


Alignment Length:291 Identity:58/291 - (19%)
Similarity:82/291 - (28%) Gaps:95/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 HEDSALGRSLPGTL--------------LSLDAQ--CRRDRGTYACFKDE----------RVCAQ 584
            |..|..|.:|.|..              |.:||.  |:|:     |..|:          .||..
Zfish    23 HRQSVRGMTLQGVANSHAGICPNDMNPNLWVDAMSTCKRE-----CQTDQECEPLEKCCANVCGS 82

  Fly   585 LFCFDAQ----TG-----------YCVAYRPAAEGSACG--NGY---HCLDGRCTPLPSNIIPDY 629
            ..|..|:    ||           .|..:....:||.|.  :|.   .|.| ||...|.......
Zfish    83 RSCVAARYIDTTGKKGPMGMPKEASCDQFMCTQQGSECDIRDGQPVCKCRD-RCEREPQFTCASD 146

  Fly   630 GHNYRLVYNKIDNKKDAAEDVESSSEETESQEDETESVEDQDEGTTSSEEQEDNKIEQSSAAGGA 694
            |..|   |||.....:|.....|.|..:........:......|||:                  
Zfish   147 GMTY---YNKCYMDAEACSKGISLSVVSCRFHLSWPNPSPLPSGTTA------------------ 190

  Fly   695 AAQSTTTARSTTTTTVRTTSTTTTTAKPKSKSFG--------YLHRSLPERQWMQDN-------- 743
               ..|||...||..........::...:|.|.|        .:...:||..|.:.:        
Zfish   191 ---LPTTALQITTPVQMQAPVILSSPTQQSASIGDTVSFLCDVVGHPVPEITWQKQSESVHMKPN 252

  Fly   744 ---GVLVTTRISSSVSSSSSGSSSGEAAATS 771
               |.:|.|.|...|..::....||....|:
Zfish   253 QVYGNVVVTNIGQLVIYNAQVQDSGIYTCTA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800
wfikkn2bXP_699239.1 WAP 41..87 CDD:278522 10/50 (20%)
KAZAL_FS 135..171 CDD:238052 10/38 (26%)
I-set 207..298 CDD:254352 14/77 (18%)
Ig 221..298 CDD:299845 12/63 (19%)
Kunitz_BPTI 317..367 CDD:278443
Kunitz_BPTI 375..425 CDD:278443
NTR_like 443..551 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.