DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and col28a1a

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:330 Identity:57/330 - (17%)
Similarity:116/330 - (35%) Gaps:107/330 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LQSVFHVDTHDAV--PHYELVQLQHHENNHNRRRRSIGKGPKVNAALPPHHVKKDLSK--NAYYS 94
            |:.||.:|:.::|  .:||:|:                  ..||:.:....|.::.::  ...||
Zfish   801 LELVFVIDSSESVGPDNYEVVK------------------DFVNSLIDHVSVSREATRVGVVLYS 847

  Fly    95 ELKHEALASGGNHLFAPEVSAIKS--HNVSFSAFGQHLNLSLRATQGLFKGAPHQLR----MWTV 153
            .:  |.:.:....|:  :.:|:|:  ..:.:...|.....::|....||:.|...:|    :.|.
Zfish   848 HV--EVVVASLQQLY--DQAAVKTAVRRMPYLGEGTFTGSAIRRATQLFQAARPGVRKVAVVLTD 908

  Fly   154 GSEPNATHGLDLQEIVHEQHTSN----DVGEV---------FQDEKNMAAI------------LM 193
            |...| ...:.|::.....|::.    .||.|         |::|.|:.|.            .:
Zfish   909 GLADN-RDAVSLKDAAEGAHSAGIEIFVVGIVNNSDSQYAEFKNEMNILASDPDENYVYLTDDFL 972

  Fly   194 RRHMETGDLI-------------MEGSIGHDLVIKPLPHELSPNPEESHHIIYKREASAAEGQLS 245
            :.|.....|:             ..|...|.....|:|....| |...:.|...:|.:       
Zfish   973 KLHALESRLLNHICEHDNGKVFSSSGKTIHPFGPDPVPDRTEP-PTSDYFITEGKEDT------- 1029

  Fly   246 DFAFMEPDDLLASEKLERLQRRQRRSRRSAPSSP-DFEDLNDED---EGALDGEPQVAES--RTR 304
                 .|.|.                 .:.|..| |::|::.:.   :|:::..|.|.|:  ..:
Zfish  1030 -----PPIDF-----------------ETLPQQPEDYDDIHIDTSYFDGSVNEIPWVTETPDGNK 1072

  Fly   305 SRRQA 309
            :|:|:
Zfish  1073 TRQQS 1077

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
Collagen 266..339 CDD:189968
Collagen 311..384 CDD:189968
Collagen 491..548 CDD:189968
Collagen 529..590 CDD:189968
Collagen 561..633 CDD:189968
Collagen 700..776 CDD:189968
VWA 803..980 CDD:306576 35/199 (18%)
Kunitz_BPTI 1117..1168 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.