DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and ADAMTSL4

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_011507946.1 Gene:ADAMTSL4 / 54507 HGNCID:19706 Length:1130 Species:Homo sapiens


Alignment Length:289 Identity:55/289 - (19%)
Similarity:92/289 - (31%) Gaps:74/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 QQSQQQQSIVEIPLVQKSLTNYSVTSSSSSTSNGAKQQPPSNKDENQRQQQQQQQAQQQLQD--- 882
            |..:.|.|...:||.:           :.|...|...:.|::....:..|:.:...:.:|:|   
Human   133 QGPRPQTSPETLPLYR-----------TQSRGRGGPLRGPASHLGREETQEIRAARRSRLRDPIK 186

  Fly   883 -----------GLPDEENEATAGIQSNEAIERQKRKFPTTPTAATSAAQKSATPA-TPATSATSA 935
                       .||...|            .|..|..|.:..:..|:..:.|.|: ||.....||
Human   187 PGMFGYGRVPFALPLHRN------------RRHPRSPPRSELSLISSRGEEAIPSPTPRAEPFSA 239

  Fly   936 RPTPTTAKPITTSSFLDAYFKKLQALHDAGSASSSTTTTTTTSVSSSVSSATSSKQQHPQQQQQ- 999
            ..:|.|..|.|          :|.....:..|...:..|..|.|:.....|  ..:.||:.|.. 
Human   240 NGSPQTELPPT----------ELSVHTPSPQAEPLSPETAQTEVAPRTRPA--PLRHHPRAQASG 292

  Fly  1000 ----QQVQQIADGSHF-LKRTPHRSSLKAYKTSSSSSNNSS---SQTQQQQQQQQQQYATNYIGD 1056
                .....:.:|..| ....|.|.|.:.:.:...:.....   |..:.:.||.|..:.|   |.
Human   293 TEPPSPTHSLGEGGFFRASPQPRRPSSQGWASPQVAGRRPDPFPSVPRGRGQQGQGPWGT---GG 354

  Fly  1057 TTNN---QP---------AVLDNSGSASS 1073
            |.:.   :|         .:|.|...|||
Human   355 TPHGPRLEPDPQHPGAWLPLLSNGPHASS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800
ADAMTSL4XP_011507946.1 TSP1 80..>110 CDD:214559
ADAM_spacer1 541..655 CDD:283607
TSP1 783..839 CDD:214559
TSP1 842..897 CDD:214559
TSP1 1033..1082 CDD:214559
PLAC 1089..1118 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.