DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and Wfikkn1

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001123248.1 Gene:Wfikkn1 / 363555 RGDID:1565835 Length:552 Species:Rattus norvegicus


Alignment Length:231 Identity:53/231 - (22%)
Similarity:79/231 - (34%) Gaps:64/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 SPPPSYLGGPGAQRC----------RWE------DGYIMSDLRHTERGFRWSACTVQSFHHFLNG 535
            ||...::||..:..|          .||      :..||...:      .:....|.|....:  
  Rat   197 SPQAVHVGGTASLHCDVSGRPPPAVTWEKQSHQRENLIMRPDQ------MYGNVVVTSIGQLV-- 253

  Fly   536 DTATCLHNAPHEDSAL----GRSLPGTL-----LSLDAQCR---RDRGTYA---CFKDERVCA-- 583
                 |:||..||:.|    .|:..|.|     ||:..:..   ||.|..|   |..|.:.|.  
  Rat   254 -----LYNAQLEDAGLYTCTARNAAGLLRADFPLSVLQRATTQDRDPGVLALAECQPDTQACVGP 313

  Fly   584 -----QLFCFDAQTGYCVAYRPA--AEGSACG-NGYHCLDGRCTPLPSNII-------PDYGHNY 633
                 .|:.||.|.|.|:.: ||  .:|:|.| ..|......|...|.::.       |..|...
  Rat   314 PTPHHVLWRFDPQRGSCMTF-PALKCDGAARGFETYEACQQACVRGPGDVCALPPVQGPCQGWEP 377

  Fly   634 RLVYNKIDNKKDAAEDVESSSEETESQEDETESVED 669
            |..|:.:  .:.....:.|..|...:..:..||.||
  Rat   378 RWAYSPL--LQQCHPFIYSGCEGNSNNFESRESCED 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 11/70 (16%)
Wfikkn1NP_001123248.1 WAP 34..80 CDD:278522
KAZAL_FS 124..159 CDD:238052
I-set 196..284 CDD:254352 21/99 (21%)
Ig_3 204..284 CDD:143242 19/92 (21%)
KU 311..356 CDD:294074 12/45 (27%)
KU 361..413 CDD:197529 10/53 (19%)
NTR_like 431..541 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.