DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and Adamts19

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001101903.2 Gene:Adamts19 / 361332 RGDID:1308359 Length:1211 Species:Rattus norvegicus


Alignment Length:426 Identity:104/426 - (24%)
Similarity:168/426 - (39%) Gaps:80/426 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 DFAFMEP--DDLLASEKLERLQRRQRRS-----RRSAPSSPDFEDLNDEDEGALDGEP---QVAE 300
            ||.|:||  |.:.......||.|::|.|     .:||........::|:      |.|   ::||
  Rat   256 DFIFIEPFNDTMAIIGHPHRLYRQKRSSEERVTEKSAAHRHHCGVISDK------GRPRSKKLAE 314

  Fly   301 SRTRSR--RQAPYIIYPEVLVIVDYDGYRLHGGDNLQVKRYFISFWNGVDLRYRLLK----GPRI 359
            :|...|  .:.|.....|.:|:.|......||.|  ..:|:.::..|.|   :.|.:    |.::
  Rat   315 NRREKRYSYKLPQDYNIETVVVADPAMVSYHGAD--AARRFILTILNMV---FNLFQHKSLGVQV 374

  Fly   360 RISIAGIIISRGRDATPYLERNRVGRDAIDSAAALTDMGKYLFRE--RRLPVY------------ 410
            .:.:..:|:.....|..|:..:  |...::|..      |:...|  |:..::            
  Rat   375 NLRVIKLILLHETPADLYIGHH--GEKMLESFC------KWQHEEFGRKNDIHLEMSTSWGEDVA 431

  Fly   411 --DIAVAITKLDMCRRTSAYGECNRGTAGFAYVGGACVVNKRLEKVNSVAIIEDTGGFSGIIVAA 473
              |.|:.||:.|.|.....  .|:  |.|.||:.|.|...::       .||.:..|.:.....|
  Rat   432 SVDAAILITRKDFCVHKDE--PCD--TVGIAYLNGMCSEKRK-------CIIAEDNGLNLAFTIA 485

  Fly   474 HEVGHLLGAVHDGSPPPSYLGGPGAQRCRWEDGYIMSDLRHTERGFRWSACTVQSFHHFLNGDTA 538
            ||:||.:|..|| :..||...|.......|..|..:.|:       .||.|:.:....||....:
  Rat   486 HEMGHNMGINHD-NDHPSCADGLHIMSGEWIKGQNLGDV-------SWSRCSKEDLERFLRSKAS 542

  Fly   539 TC-LHNAPHEDSA--LGRSLPGTLLSLDAQCRRDRGTYACFKDER---VCAQLFC-FDAQTGYCV 596
            :| ||..|...|:  :...|||...:.|.||:...|..|.|..|.   :|..|:| .:..|....
  Rat   543 SCLLHTDPQSLSSVLVPSKLPGMAYTADEQCQILFGPLASFCQEMQHVICTGLWCRVEGDTECRT 607

  Fly   597 AYRPAAEGSACGNGYHCLDGRC---TPLPSNIIPDY 629
            ...|..:|:.|..|..|..|.|   ||.|.::..::
  Rat   608 KLDPPMDGTDCDPGKWCKAGECTRRTPAPEHLAGEW 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 55/249 (22%)
Adamts19NP_001101903.2 Pep_M12B_propep 162..277 CDD:396235 7/20 (35%)
ZnMc_ADAMTS_like 329..546 CDD:239801 55/248 (22%)
ADAM_CR_2 563..630 CDD:407643 19/66 (29%)
ADAM_spacer1 794..904 CDD:368694
TSP1_ADAMTS 928..980 CDD:408800
TSP1_ADAMTS 984..1040 CDD:408800
TSP1_ADAMTS 1044..1086 CDD:408800
TSP1_ADAMTS 1095..1147 CDD:408800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.