DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and ADAMTSL5

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:XP_011526263.1 Gene:ADAMTSL5 / 339366 HGNCID:27912 Length:485 Species:Homo sapiens


Alignment Length:145 Identity:35/145 - (24%)
Similarity:43/145 - (29%) Gaps:52/145 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 PGAQRCRWEDG--YIMSDLRHTERG---FRWSACTVQS---------------FHHFLNGDTATC 540
            ||.:.| |.|.  |.:..|.....|   ||...|.:.:               ||...|.....|
Human    76 PGEEPC-WGDSHEYRLCQLPDCPPGAVPFRDLQCALYNGRPVLGTQKTYQWVPFHGAPNQCDLNC 139

  Fly   541 LHNAPHEDSALGRSLPGTLLSLDAQCRRDRGTYACFKDERVCAQLFCFDAQTGYCVAYRPAAEG- 604
            |........:.||.|.||..|..||                           |.|||.|..:.| 
Human   140 LAEGHAFYHSFGRVLDGTACSPGAQ---------------------------GVCVAGRCLSAGC 177

  Fly   605 -SACGNGYHCLDGRC 618
             ...|:|  .|:.||
Human   178 DGLLGSG--ALEDRC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 15/65 (23%)
ADAMTSL5XP_011526263.1 TSP1 48..97 CDD:214559 7/21 (33%)
ADAM_CR <106..174 CDD:301627 19/94 (20%)
ADAM_spacer1 206..315 CDD:283607
NTR_like 379..480 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.