| Sequence 1: | NP_001137746.1 | Gene: | sona / 37762 | FlyBaseID: | FBgn0034903 | Length: | 1102 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_220855.1 | Gene: | Wfikkn2 / 287631 | RGDID: | 1305361 | Length: | 571 | Species: | Rattus norvegicus |
| Alignment Length: | 205 | Identity: | 42/205 - (20%) |
|---|---|---|---|
| Similarity: | 67/205 - (32%) | Gaps: | 74/205 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 440 YVGGACVVNKRLEKVNSVAIIEDTG-------GFSGIIVAAHEVGHLLG----AVHDGS------ 487
Fly 488 PPPSYLGGPGAQRC-----RWE------------DGYIMSDLRHTERGFRWSACTVQSFHHFLNG 535
Fly 536 DTATCLHNAPHEDSALGRSLPGTLLSLDAQCRRDRGTYACFKDERVCAQLFCFDAQTGYCVAYRP 600
Fly 601 AAEGSACGNG 610 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sona | NP_001137746.1 | ZnMc_salivary_gland_MPs | 313..542 | CDD:239800 | 29/135 (21%) |
| Wfikkn2 | XP_220855.1 | WAP | 37..86 | CDD:395047 | |
| KAZAL_FS | 133..169 | CDD:238052 | |||
| IgI_3_WFIKKN-like | 205..299 | CDD:409422 | 10/44 (23%) | ||
| Ig strand B | 222..226 | CDD:409422 | |||
| Ig strand C | 235..239 | CDD:409422 | |||
| Ig strand E | 257..261 | CDD:409422 | 1/3 (33%) | ||
| Ig strand F | 279..284 | CDD:409422 | 0/4 (0%) | ||
| Ig strand G | 292..295 | CDD:409422 | 1/2 (50%) | ||
| Kunitz_BPTI | 323..374 | CDD:394972 | 11/57 (19%) | ||
| Kunitz_BPTI | 380..431 | CDD:394972 | 15/72 (21%) | ||
| NTR_WFIKKN | 450..558 | CDD:239630 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3538 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||