DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and Adamts14

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001074596.1 Gene:Adamts14 / 237360 MGIID:2179942 Length:1206 Species:Mus musculus


Alignment Length:557 Identity:139/557 - (24%)
Similarity:210/557 - (37%) Gaps:161/557 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PEVSAIKSHNVSF--SAFGQHLNLSLRATQGLF-KGAPHQLRMWTVGSEPNATHGLDLQEIVHEQ 172
            |.....:.|.:.|  :.||:.|:|.|:..:.|. .|||                 ::.||     
Mouse    83 PRPGGPRQHFLYFNVTVFGKLLHLRLQPNRRLVAPGAP-----------------VEWQE----- 125

  Fly   173 HTSNDVGEVFQDEKNMAAILMRRHMETGDLI-MEGSI----------------GHDLVIKPLPHE 220
                |..|:|:..      |.:..:.||.:. |.|:.                ..|..|:||  |
Mouse   126 ----DFRELFRQP------LQQECVYTGGVTGMPGAAVAISNCDGLAGLIRTDNSDYFIEPL--E 178

  Fly   221 LSPNPEES---HHIIYKREASAAE-----GQLSDFAFMEPD-----DLLASEKLERLQRRQRRSR 272
            .....:|:   .|::|:|||...|     |.|.:.||...|     ||:.    :||...:|:.|
Mouse   179 RGQQEKEAGGRTHVVYRREAVQREWKEPHGDLHNEAFGLGDLPNVLDLVG----DRLGDAERKRR 239

  Fly   273 RSAPSSPDFEDLNDEDEGALDGEPQVAESRTRSRRQAPYIIYPEVLVIVDYDGYRLHGGDNLQVK 337
            .:.|.|                                |.|  |||:.||....|.||.::.|  
Mouse   240 HAKPGS--------------------------------YSI--EVLLAVDDSVVRFHGREHTQ-- 268

  Fly   338 RYFISFWNGVDLRYR-LLKGPRIRISIAGIIISRGRDATPYLERNRVGRDAIDSAAALTDMGKYL 401
            .|.::..|.||..|. ...|..:.|::..:|:...|.:...:||.       :.|.:|..:.::.
Mouse   269 NYVLTLMNIVDEIYHDESLGAHVNIALVRLIMVGYRQSLSLIERG-------NPARSLEQVCRWA 326

  Fly   402 FRERR-----LPVYDIAVAITKLDMCRRTSAYGECNRGTAGFAYVGGACVVNKRLEKVNSVAIIE 461
            ..::|     ...:|..:.:|:.            |.|.:|:|.|.|.|      ..:.|.|:..
Mouse   327 HSQQRQDPSHTEHHDHVIFLTRQ------------NFGPSGYAPVTGMC------HPLRSCALNH 373

  Fly   462 DTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLGGPGAQRCRWED--GYIMSDL-RHTERGFRWSA 523
            : .|||...|.|||.||:||..|||.       |.|   |..|.  |.:|:.| :.....|.||.
Mouse   374 E-DGFSSAFVVAHETGHVLGMEHDGQ-------GNG---CDDETSLGSVMAPLVQAAFHRFHWSR 427

  Fly   524 CTVQSFHHFLNGDTATCLHNAPHEDS-ALGRSLPGTLLSLDAQCRRDRGT--YAC--FKDERVCA 583
            |:......:|  .:..||.:.|.|.: .....|||...|:|.|||.|.||  :.|  |:....|.
Mouse   428 CSKLELSRYL--PSYDCLLDDPFERTWPQPPELPGIDYSMDEQCRFDFGTGYHTCLAFRTFEPCK 490

  Fly   584 QLFCFDAQTGY-CVAYR-PAAEGSACGNGYHCLDGRC 618
            ||:|......| |...: |..:|:.|..|..|..|.|
Mouse   491 QLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHC 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 62/237 (26%)
Adamts14NP_001074596.1 Pep_M12B_propep 80..193 CDD:279848 29/143 (20%)
ZnMc_ADAMTS_like 246..444 CDD:239801 63/239 (26%)
Reprolysin 248..447 CDD:279729 63/240 (26%)
TSP1 542..594 CDD:214559
ADAM_spacer1 701..816 CDD:283607
TSP1 836..894 CDD:214559
TSP1 898..956 CDD:214559
TSP_1 961..1008 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.