DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and Adamtsl4

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_001288634.1 Gene:Adamtsl4 / 229595 MGIID:2389008 Length:1036 Species:Mus musculus


Alignment Length:220 Identity:45/220 - (20%)
Similarity:74/220 - (33%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   848 SSSTSNG-AKQQPPSNKDENQRQQQQQQQAQQQLQDGLPDEENEATAGIQSNEAIERQKRKFPTT 911
            :|||..| ...||||.:..:::.....|                                  |..
Mouse   177 NSSTGEGMVPSQPPSTELASEKHGPHMQ----------------------------------PPE 207

  Fly   912 PTAATSAAQKSATPATPATSATSARPTPTTAKPITTSSFLDAYFKKLQALHDAGSASSSTTTTTT 976
            |.:.::...:|.|..|.....||:.|: .|..|..||||.|:  :..|     ||.......:  
Mouse   208 PRSHSAETPRSGTAQTEVLPRTSSAPS-YTGTPAPTSSFGDS--RSFQ-----GSLGPRMPPS-- 262

  Fly   977 TSVSSSVSSATSSKQQH-------PQQQQQQQVQQIADGSHFLKRTPHR------------SSLK 1022
               ..|.||...::::|       |:.||.::        |:....|||            |.|.
Mouse   263 ---PGSWSSPQGAERRHPPPFSPVPRSQQSRR--------HWRPPGPHRSPDGWLPLTRDSSPLW 316

  Fly  1023 AYKTSSSSSNNSSSQTQQQQQQQQQ 1047
            :....|..:.|.|.:::|.:...|:
Mouse   317 SIFAPSIPAPNCSGESEQMRACSQE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800
Adamtsl4NP_001288634.1 TSP1 46..>70 CDD:214559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..149
PHA03247 <161..360 CDD:223021 45/220 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..308 38/185 (21%)
ADAM_spacer1 449..563 CDD:368694
TSP1_ADAMTS 638..687 CDD:408800
TSP1_ADAMTS 691..747 CDD:408800
TSP1_ADAMTS 755..805 CDD:408800
TSP1_ADAMTS 809..870 CDD:408800
TSP1_ADAMTS 876..932 CDD:408800
TSP1_ADAMTS 936..987 CDD:408800
PLAC 995..1024 CDD:400844
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.