DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and mig-17

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_505901.2 Gene:mig-17 / 179575 WormBaseID:WBGene00003248 Length:509 Species:Caenorhabditis elegans


Alignment Length:255 Identity:76/255 - (29%)
Similarity:117/255 - (45%) Gaps:46/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 IDSAAALTDMGKYLFRERRLPVYDIAVAITKLDMCRRTSAYGECNRGTAGFAYVGGACVVNKRLE 452
            |||..|:.....:|..:..||.::.||.|||.|:   .|..|  |..|.|.||||..|      |
 Worm   227 IDSKKAIDKFTIWLKEQTGLPRHEHAVLITKFDL---ISING--NSATQGMAYVGNIC------E 280

  Fly   453 KVNSVAIIEDTGGFSGIIVAAHEVGHLLGAVHDGSPPPSYLGGPGAQRCRWEDGYIM-------S 510
            ..:|.:::||.|.....::.|||:||.|||:|||:...:        .|...|.|:|       :
 Worm   281 NGDSSSVVEDIGAGLTSLIMAHEIGHSLGALHDGAYETA--------ECDSNDNYLMAVAVSGSA 337

  Fly   511 DLRHTERGFRWSACTVQSFHHFLNGDTATCLHNAPHEDSALGRSL--------PGTLLSLDAQCR 567
            |.:......|.|.|::.|....|...||.|:..   ..:..|:.:        ||.|:.:..||:
 Worm   338 DRQSFLNSRRMSNCSINSIIENLKEPTANCVKK---WKTKKGKDVSQKDFIKKPGELVKITRQCQ 399

  Fly   568 RDRG-TY-AC-----FKDERVCAQLFCFDAQTGYC--VAYRPAAEGSACGNGYHCLDGRC 618
            ...| |: .|     |.::.:|.:::|.|.::..|  :.|.||.:|:.||....||:|.|
 Worm   400 VAFGPTFIPCLHIGYFHEQSICERIWCSDGESDECQTLNYFPAFDGTECGYNMWCLEGSC 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 52/160 (33%)
mig-17NP_505901.2 ZnMc_ADAM_like 162..361 CDD:239795 48/152 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7083
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6268
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012737
OrthoInspector 1 1.000 - - oto20580
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.