Sequence 1: | NP_001137746.1 | Gene: | sona / 37762 | FlyBaseID: | FBgn0034903 | Length: | 1102 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_783165.1 | Gene: | WFIKKN2 / 124857 | HGNCID: | 30916 | Length: | 576 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 43/206 - (20%) |
---|---|---|---|
Similarity: | 68/206 - (33%) | Gaps: | 76/206 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 440 YVGGACVVNKRLEKVNSVAIIEDTG-------GFSGIIVAAHEV----GHLLGAVHDGSP----- 488
Fly 489 -------PPSYLGGPGAQRCRWE------------DGYIMSDLRHTERGFRWSACTVQSFHHFLN 534
Fly 535 GDTATCLHNAPHEDSALGRSLPGTLLSLDAQCRRDRGTYACFKDERVCAQLFCFDAQTGYCVAYR 599
Fly 600 PAAEGSACGNG 610 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sona | NP_001137746.1 | ZnMc_salivary_gland_MPs | 313..542 | CDD:239800 | 29/136 (21%) |
WFIKKN2 | NP_783165.1 | WAP | 44..90 | CDD:278522 | |
KAZAL_FS | 138..174 | CDD:238052 | |||
I-set | 216..304 | CDD:254352 | 10/44 (23%) | ||
Ig_3 | 224..304 | CDD:143242 | 10/44 (23%) | ||
Kunitz_BPTI | 328..379 | CDD:278443 | 11/58 (19%) | ||
Kunitz_BPTI | 385..436 | CDD:278443 | 15/72 (21%) | ||
NTR_WFIKKN | 455..563 | CDD:239630 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3538 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |