DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sona and WFIKKN2

DIOPT Version :9

Sequence 1:NP_001137746.1 Gene:sona / 37762 FlyBaseID:FBgn0034903 Length:1102 Species:Drosophila melanogaster
Sequence 2:NP_783165.1 Gene:WFIKKN2 / 124857 HGNCID:30916 Length:576 Species:Homo sapiens


Alignment Length:206 Identity:43/206 - (20%)
Similarity:68/206 - (33%) Gaps:76/206 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 YVGGACVVNKRLEKVNSVAIIEDTG-------GFSGIIVAAHEV----GHLLGAVHDGSP----- 488
            :|.|..||....:.|...|.::|.|       ..:|::.|...:    ||...|..:.||     
Human   259 HVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADFPLSVVRGHQAAATSESSPNGTAF 323

  Fly   489 -------PPSYLGGPGAQRCRWE------------DGYIMSDLRHTERGFRWSACTVQSFHHFLN 534
                   ||. ....|.::.||.            .|:...:|.|.|   .:.||.:..    ::
Human   324 PAAECLKPPD-SEDCGEEQTRWHFDAQANNCLTFTFGHCHRNLNHFE---TYEACMLAC----MS 380

  Fly   535 GDTATCLHNAPHEDSALGRSLPGTLLSLDAQCRRDRGTYACFKDERVCAQLFCFDAQTGYCVAYR 599
            |..|.|             |||    :|...|             :..|..:.:::|||.|.:: 
Human   381 GPLAAC-------------SLP----ALQGPC-------------KAYAPRWAYNSQTGQCQSF- 414

  Fly   600 PAAEGSACGNG 610
              ..|...|||
Human   415 --VYGGCEGNG 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sonaNP_001137746.1 ZnMc_salivary_gland_MPs 313..542 CDD:239800 29/136 (21%)
WFIKKN2NP_783165.1 WAP 44..90 CDD:278522
KAZAL_FS 138..174 CDD:238052
I-set 216..304 CDD:254352 10/44 (23%)
Ig_3 224..304 CDD:143242 10/44 (23%)
Kunitz_BPTI 328..379 CDD:278443 11/58 (19%)
Kunitz_BPTI 385..436 CDD:278443 15/72 (21%)
NTR_WFIKKN 455..563 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.