DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and TMH11

DIOPT Version :9

Sequence 1:NP_001286781.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_012618.3 Gene:TMH11 / 853547 SGDID:S000003845 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:99 Identity:33/99 - (33%)
Similarity:49/99 - (49%) Gaps:7/99 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YVYAATVAAGGIMGYAKAGSIPSLGAGLAFGA---LLGYGAHLNSQDTPRPLLQLGTSLFLAGLM 69
            |..:....|||:|||.:.||||||.:||.||:   :.||..|:|........|...|.|..||::
Yeast     6 YTLSLLTTAGGLMGYYRKGSIPSLVSGLVFGSVYGIAGYLLHMNRDGGLEMALGASTLLLGAGVI 70

  Fly    70 GARWNRSGKLMPAGMVCMLSVAALVKNLATYNRY 103
            ....:|..|.:|.    :|:....:.:...||:|
Yeast    71 RGMPSRFTKPVPV----VLTALGGLGSYYYYNKY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_001286781.1 Tmemb_14 5..94 CDD:281626 30/88 (34%)
TMH11NP_012618.3 COG5548 1..105 CDD:227835 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I1854
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000753
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X790
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.