DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and AT3G43520

DIOPT Version :10

Sequence 1:NP_611826.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_566866.1 Gene:AT3G43520 / 823438 AraportID:AT3G43520 Length:240 Species:Arabidopsis thaliana


Alignment Length:84 Identity:35/84 - (41%)
Similarity:49/84 - (58%) Gaps:7/84 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPLLQLGTSLFLAG----LMG 70
            ||..|..||:|||.|:||..||.||....|:|.|   :.||...:|:|.....:.:||    :||
plant   144 YAFLVGVGGLMGYLKSGSQKSLLAGGLSAAVLLY---VFSQLPTKPVLASTVGVVMAGALMYVMG 205

  Fly    71 ARWNRSGKLMPAGMVCMLS 89
            .|:.||.|:.|||:|.::|
plant   206 TRYMRSKKIFPAGVVSIMS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_611826.1 Tmemb_14 6..94 CDD:461004 35/84 (42%)
AT3G43520NP_566866.1 Tmemb_14 140..229 CDD:461004 35/84 (42%)

Return to query results.
Submit another query.