DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and AT3G20510

DIOPT Version :9

Sequence 1:NP_001286781.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_188687.1 Gene:AT3G20510 / 821597 AraportID:AT3G20510 Length:119 Species:Arabidopsis thaliana


Alignment Length:114 Identity:35/114 - (30%)
Similarity:51/114 - (44%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLN-------SQDTPRPLLQLGTSL 63
            |...|...:..||.:||.|.|||.|...|...|.||....:::       ...|...:||...:.
plant     6 FTIPYGMLLIGGGFIGYMKKGSITSFAGGAGTGLLLILAGYISLKAFEKKKNSTIAMVLQTVIAA 70

  Fly    64 FLAGLMGARWNRSGKLMPAGMVCMLSVAALVKNLATYNRYLMPAGTKAP 112
            .|..:||.|:..:||:||||:|.  .::||:.....|.  :...|.|.|
plant    71 ALTLVMGQRYLLTGKIMPAGLVA--GISALMTCFYVYK--IATGGNKFP 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_001286781.1 Tmemb_14 5..94 CDD:281626 30/94 (32%)
AT3G20510NP_188687.1 Tmemb_14 5..101 CDD:397626 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4267
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2627
OMA 1 1.010 - - QHG55327
OrthoDB 1 1.010 - - D1642026at2759
OrthoFinder 1 1.000 - - FOG0000753
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102546
Panther 1 1.100 - - O PTHR12668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.