DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and tmem14c

DIOPT Version :9

Sequence 1:NP_001286781.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001072424.1 Gene:tmem14c / 779878 XenbaseID:XB-GENE-876311 Length:107 Species:Xenopus tropicalis


Alignment Length:90 Identity:53/90 - (58%)
Similarity:64/90 - (71%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPLLQLGTSLFL 65
            |.|||||:.|||.||:||||||.||||:|||.|||.||:|.|.||:..|.|:...||.|..|..|
 Frog     1 MGVDWFGFGYAALVASGGIMGYVKAGSVPSLAAGLLFGSLAGLGAYQMSNDSKNVLLSLIASGTL 65

  Fly    66 AGLMGARWNRSGKLMPAGMVCMLSV 90
            ||:||.|:..|||.||||::...|:
 Frog    66 AGVMGFRFYNSGKFMPAGIIAGASL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_001286781.1 Tmemb_14 5..94 CDD:281626 50/86 (58%)
tmem14cNP_001072424.1 Tmemb_14 5..94 CDD:367594 50/86 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1642026at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4799
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.