DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and TMEM14C

DIOPT Version :9

Sequence 1:NP_001286781.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001158730.1 Gene:TMEM14C / 51522 HGNCID:20952 Length:112 Species:Homo sapiens


Alignment Length:103 Identity:53/103 - (51%)
Similarity:71/103 - (68%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPLLQLGTSLFL 65
            :|:.|||:.|||.||:|||:||.||||:|||.|||.||:|.|.||:..|||.....:.|.||..|
Human     8 VPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTL 72

  Fly    66 AGLMGARWNRSGKLMPAGMVCMLSVAALVK-NLATYNR 102
            ||:||.|:..|||.||||::...|:..:.| .::.:||
Human    73 AGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNR 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_001286781.1 Tmemb_14 5..94 CDD:281626 49/88 (56%)
TMEM14CNP_001158730.1 Tmemb_14 12..101 CDD:367594 49/88 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157831
Domainoid 1 1.000 97 1.000 Domainoid score I7259
eggNOG 1 0.900 - - E1_KOG4267
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4967
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55327
OrthoDB 1 1.010 - - D1642026at2759
OrthoFinder 1 1.000 - - FOG0000753
OrthoInspector 1 1.000 - - otm40548
orthoMCL 1 0.900 - - OOG6_102546
Panther 1 1.100 - - LDO PTHR12668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4799
SonicParanoid 1 1.000 - - X790
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.