DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and SPAP14E8.05c

DIOPT Version :9

Sequence 1:NP_001286781.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_593541.1 Gene:SPAP14E8.05c / 2541802 PomBaseID:SPAP14E8.05c Length:101 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:27/101 - (26%)
Similarity:45/101 - (44%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPL-LQLGTSLF 64
            |..|....|.:..:..||::||.:..|..||.||.|.||...:.:.|..:.:.:.: .....||.
pombe     1 MTPDQNALVLSFLLTVGGLIGYLRKKSKVSLIAGTALGANFAWASKLMERGSSQGINYAFYGSLV 65

  Fly    65 LAGLMGARWNRSGKLMPAGMVCMLSVAALVKNLATY 100
            |....|.|:.:|.|.:|    .:|:|..::.....|
pombe    66 LLASSGPRFYKSRKPVP----MILTVLGVISTWYFY 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_001286781.1 Tmemb_14 5..94 CDD:281626 24/89 (27%)
SPAP14E8.05cNP_593541.1 COG5548 1..101 CDD:227835 27/101 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4267
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000753
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.