DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5532 and LOC100361993

DIOPT Version :9

Sequence 1:NP_001286781.1 Gene:CG5532 / 37761 FlyBaseID:FBgn0034902 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_038947428.1 Gene:LOC100361993 / 100361993 RGDID:2319087 Length:114 Species:Rattus norvegicus


Alignment Length:96 Identity:52/96 - (54%)
Similarity:66/96 - (68%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVDWFGYVYAATVAAGGIMGYAKAGSIPSLGAGLAFGALLGYGAHLNSQDTPRPLLQLGTSLFL 65
            :|:.::|:.|||.||.|||:|||||||:|||.|||.||.|.|.||:..|||.....:.|.||..|
  Rat     9 VPLHYYGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLATSGTL 73

  Fly    66 AGLMGARWNRSGKLMPAGMVC---MLSVAAL 93
            ||:||.|:..|||.||||::.   :|.||.|
  Rat    74 AGIMGMRFYNSGKFMPAGLIAGTSLLMVAKL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5532NP_001286781.1 Tmemb_14 5..94 CDD:281626 51/92 (55%)
LOC100361993XP_038947428.1 Tmemb_14 13..102 CDD:397626 48/88 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351794
Domainoid 1 1.000 92 1.000 Domainoid score I7410
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I4934
OMA 1 1.010 - - QHG55327
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000753
OrthoInspector 1 1.000 - - otm44685
orthoMCL 1 0.900 - - OOG6_102546
Panther 1 1.100 - - LDO PTHR12668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X790
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.