DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11300 and AGP5

DIOPT Version :9

Sequence 1:NP_611825.1 Gene:CG11300 / 37760 FlyBaseID:FBgn0034901 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_564455.1 Gene:AGP5 / 840412 AraportID:AT1G35230 Length:133 Species:Arabidopsis thaliana


Alignment Length:108 Identity:38/108 - (35%)
Similarity:51/108 - (47%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRCQFVIAFGLLALIATAYADSPPAAGSPPASSPPAGTPTSPPPATGTPPSPSPATGTPPSASPA 65
            |..:.|:.|..|||:|::.....|  |..|..||...|||.......|.|:|||:...|||| |.
plant     1 MASKSVVVFLFLALVASSVVAQAP--GPAPTISPLPATPTPSQSPRATAPAPSPSANPPPSA-PT 62

  Fly    66 AGTPTSPTPATGTPSSPATPDAPASSTSPATPTSPSDSGSSSS 108
            ...|.|..|   |.|.||.|.:.:.|.:|.|.....::|.:.|
plant    63 TAPPVSQPP---TESPPAPPTSTSPSGAPGTNVPSGEAGPAQS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11300NP_611825.1 Pacs-1 <3..>75 CDD:287256 26/71 (37%)
AGP5NP_564455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.