DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12491 and CG34105

DIOPT Version :9

Sequence 1:NP_611824.1 Gene:CG12491 / 37759 FlyBaseID:FBgn0034900 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001036567.1 Gene:CG34105 / 4379881 FlyBaseID:FBgn0083941 Length:157 Species:Drosophila melanogaster


Alignment Length:157 Identity:157/157 - (100%)
Similarity:157/157 - (100%) Gaps:0/157 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRPEFVLAFGLVVLVATVYGGTDSSSSDSSSSTSPTSNSSTPSTSSSSSTPSSSSSTSTPSSNST 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MRPEFVLAFGLVVLVATVYGGTDSSSSDSSSSTSPTSNSSTPSTSSSSSTPSSSSSTSTPSSNST 65

  Fly    66 TSTSSSTPSSSSSTSPTSSTSSTTATTTAPSTSSDTSSSSTSSDSEEVDRLRRRLRRLRRLRRQE 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 TSTSSSTPSSSSSTSPTSSTSSTTATTTAPSTSSDTSSSSTSSDSEEVDRLRRRLRRLRRLRRQE 130

  Fly   131 RRQEIRRERQQERRQQSRAGRRRQRRG 157
            |||||||||||||||||||||||||||
  Fly   131 RRQEIRRERQQERRQQSRAGRRRQRRG 157



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.