DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egl and AT2G25910

DIOPT Version :9

Sequence 1:NP_001286779.1 Gene:egl / 37757 FlyBaseID:FBgn0000562 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001031418.1 Gene:AT2G25910 / 817132 AraportID:AT2G25910 Length:342 Species:Arabidopsis thaliana


Alignment Length:224 Identity:69/224 - (30%)
Similarity:112/224 - (50%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   508 ANHSPSHSYFVGDTWKIKVLQNTTVIANVKQSVFVTDIILKYAAKNESIVVSLDCEGINLGLKGE 572
            ||..|...|.|.|.:::.                 .|.:  ..:..:.:|:..||||::|...|:
plant    27 ANEPPVPIYIVTDPFQLP-----------------ADFL--NPSPEKKLVIGFDCEGVDLCRHGK 72

  Fly   573 ITLIEIGTTRGEAFLFDVQSCPAMVTDGG------LKTVLEHDQVIKVIHDCRNDAANLYLQFGI 631
            :.:::|..:.. .:|.|       |.:||      .|..||.:.:.||||||:.|:..||.||||
plant    73 LCIMQIAFSNA-IYLVD-------VIEGGEVIMKACKPALESNYITKVIHDCKRDSEALYFQFGI 129

  Fly   632 LLRNVFDTQAAHAILQYQESGKQVYKAKYISLNSLC--EQYNAPCNPIKDQLKQIYRRDQKFWAK 694
            .|.||.|||.|:::::.|| |::.....|||..||.  .:|.......|::::.:.|:|.|||..
plant   130 RLHNVVDTQIAYSLIEEQE-GRRRPLDDYISFVSLLADPRYCGISYEEKEEVRVLMRQDPKFWTY 193

  Fly   695 RPLTREMMLYAAGDV--LVLIHDQLFGNL 721
            ||:|..|:..||.||  |:.::.::.|.|
plant   194 RPMTELMIRAAADDVRFLLYLYHKMMGKL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eglNP_001286779.1 Egl_like_exo 541..744 CDD:99851 63/191 (33%)
AT2G25910NP_001031418.1 Egl_like_exo 46..242 CDD:99851 63/188 (34%)
KH 276..336 CDD:197652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2414
eggNOG 1 0.900 - - E1_KOG2405
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003633
OrthoInspector 1 1.000 - - oto4074
orthoMCL 1 0.900 - - OOG6_109411
Panther 1 1.100 - - LDO PTHR46814
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.