DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment egl and exd1

DIOPT Version :9

Sequence 1:NP_001286779.1 Gene:egl / 37757 FlyBaseID:FBgn0000562 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001038930.1 Gene:exd1 / 751755 ZFINID:ZDB-GENE-060825-267 Length:378 Species:Danio rerio


Alignment Length:183 Identity:48/183 - (26%)
Similarity:76/183 - (41%) Gaps:36/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 DCEGINLGLKGE-----ITLIEIGTTRGEAFLFDVQSCPAMVTDGGLKTVLEHDQVIKVIHDCRN 620
            |..||...:.|:     :..:::.|.: ..:|||:..........||..:||:..::||:||||.
Zfish   135 DVIGIGADVYGQSGQERLCWLQVATKK-VVYLFDILLLGGPAFKNGLSMILENTHILKVLHDCRC 198

  Fly   621 DAANLYLQFGILLRNVFDTQAAHAILQYQESG-------------KQVY-KAKYISLNSLCEQ-- 669
            ....|..:|.:.|.||||||.|..:|.:.|||             .|:: :.....:..||.:  
Zfish   199 ITRCLRTEFRVQLTNVFDTQVAELLLFFNESGGFLPDRPASLPELLQLHLRLTTAEIQPLCSKQQ 263

  Fly   670 ---------YNAPCNPIKDQLKQIYRRDQKFWAKRPLTREMMLYAAGDVLVLI 713
                     |..||.|  |.|..:....|...:.|.|..:.:|   .|..||:
Zfish   264 QSRECVQLWYVRPCPP--DLLSLMCSSVQHLLSLRLLLLDALL---ADYTVLV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eglNP_001286779.1 Egl_like_exo 541..744 CDD:99851 48/183 (26%)
exd1NP_001038930.1 DnaQ_like_exo 125..>282 CDD:299142 40/149 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003633
OrthoInspector 1 1.000 - - oto38958
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.