DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and pnp4b

DIOPT Version :9

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_991206.1 Gene:pnp4b / 402940 ZFINID:ZDB-GENE-040426-1887 Length:304 Species:Danio rerio


Alignment Length:253 Identity:94/253 - (37%)
Similarity:140/253 - (55%) Gaps:3/253 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FEEVEAMAKYIVNVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEP--DCSFVLG 109
            |::.:...:::::.:..|||..::|||.|..:...|.......||||||||....|  :...|.|
Zfish    12 FDDCKLTTEWLLSRTRHRPKIAVVCGSGLGLLADNVPNKQSFRYEDIPNFPVSTVPGHEGCLVFG 76

  Fly   110 TVMGAPIIALVHSFHSCDGYNLATCALPVRVMQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHI 174
            .:.|...:.:...||..:||:|.....|||:.:|.||.||::|:.:..:...|.:||||:::|||
Zfish    77 QIKGKSCVFMQGRFHLYEGYSLCKVTFPVRIFKLMGVETIIVTNASGGLCQDFKVGDIMVIKDHI 141

  Fly   175 NVVGMMHQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPILG 239
            |:.|...|.||.||:|.|||.|...|.:||.|||.:..::|...:|...|:|.||...:.||...
Zfish   142 NLPGFAGQHPLCGPNDERFGIRFPCMSDAYSKDLRKLVMDITAELGYSNFVHEGVYCMVSGPNFE 206

  Fly   240 TVAEERMLRTMEVSAVGMSLVPEVIAAHHGGLKVLAFVVISRAAS-DKESEESDKDKE 296
            |:||.|||..:...:||||.||||..|.|.||:|:...:|:...| |...||....:|
Zfish   207 TIAEARMLHILGSDSVGMSTVPEVTVAKHCGLRVMGLSLITNKVSLDYSREEKVNHEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 PNP_UDP_1 46..280 CDD:294213 88/234 (38%)
XapA 50..280 CDD:223084 87/231 (38%)
pnp4bNP_991206.1 PRK08202 18..286 CDD:236183 93/247 (38%)
XapA 25..286 CDD:223084 93/240 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58962
OrthoDB 1 1.010 - - D1078969at2759
OrthoFinder 1 1.000 - - FOG0001804
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11904
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1164
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.