DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18128 and Mtap

DIOPT Version :9

Sequence 1:NP_611822.1 Gene:CG18128 / 37756 FlyBaseID:FBgn0034898 Length:339 Species:Drosophila melanogaster
Sequence 2:NP_001261049.1 Gene:Mtap / 36955 FlyBaseID:FBgn0034215 Length:360 Species:Drosophila melanogaster


Alignment Length:221 Identity:46/221 - (20%)
Similarity:84/221 - (38%) Gaps:22/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVSHIRPKYGLICGSFLSDMVSLVEQPVVIPYEDIPNFPDGIEPDCSFVLGTVMGAPIIALVHSF 123
            |:..:..|.|:|.||.|.| ..::||    ..|.:...|.| ||..:.:.|.:.|...:.|....
  Fly    10 NLDPLPVKIGIIGGSGLDD-PDILEQ----RQERVVETPYG-EPSDALIEGEINGVQCVLLARHG 68

  Fly   124 HSCDGYNLATCALPVRV--------MQLCGVRTIMLTSEAAAVDHGFALGDIMLVQDHINVVGMM 180
            ...|       .:|..|        ::..|...:::::...::......|::::..|.|:.....
  Fly    69 RKHD-------IMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKR 126

  Fly   181 HQTPLEGPSDPRFGSRRFSMVNAYDKDLLEKALEIGKRMGIQKFLHSGVLACMGGPILGTVAEER 245
            .||..:|.:....|.....|..|:.:......|:..|.:.|... ....:..:.||...:.:|..
  Fly   127 LQTFYDGKAQSPRGVCHLPMFPAFSERTRNILLQAAKELEIPAH-DKATIVTIEGPRFSSRSESH 190

  Fly   246 MLRTMEVSAVGMSLVPEVIAAHHGGL 271
            |.|......:.|:..|||:.|...||
  Fly   191 MFRQWGGDLINMTTCPEVVLAKEAGL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18128NP_611822.1 PNP_UDP_1 46..280 CDD:294213 46/221 (21%)
XapA 50..280 CDD:223084 46/221 (21%)
MtapNP_001261049.1 XapA 12..264 CDD:223084 45/219 (21%)
PNP_UDP_1 17..263 CDD:294213 45/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0005
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.