DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL43 and Mrpl43

DIOPT Version :9

Sequence 1:NP_523828.1 Gene:mRpL43 / 37750 FlyBaseID:FBgn0034893 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_444394.1 Gene:Mrpl43 / 94067 MGIID:2137229 Length:159 Species:Mus musculus


Alignment Length:152 Identity:65/152 - (42%)
Similarity:88/152 - (57%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGFPRAPLQNGLGRYVCQLQRITLKFCKNNGSSRGMRDFIENHLLDFAKENPGIVVYVKPRRHRT 74
            |.|..:.|.|||||||.||||::|...::..||||.|:|:|..:.|||:.|||:||||.||....
Mouse     8 SRFLTSVLHNGLGRYVQQLQRLSLSLSRDAPSSRGAREFVEREVTDFARRNPGVVVYVNPRPCAM 72

  Fly    75 PVLVGEYLNGEREWMSCRNSTQEEISKWIDLLKTQNGSSSSLRLRKMWHTEVPSIQGPWTPFL-- 137
            |.:|.|||||.....:..:.:.|||...:..|..|:| ...:|:||.:||:.|||||.|.||.  
Mouse    73 PRIVAEYLNGAVREENVNSKSVEEIKSLVQKLADQSG-LDVIRIRKPFHTDNPSIQGQWHPFTNK 136

  Fly   138 ------LRSPDAQGQAYPSAEA 153
                  ||..:.:..|..|.:|
Mouse   137 RTALHGLRPRELRDSAPASMQA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL43NP_523828.1 L51_S25_CI-B8 40..109 CDD:197984 30/68 (44%)
Mrpl43NP_444394.1 L51_S25_CI-B8 38..107 CDD:197984 30/68 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849675
Domainoid 1 1.000 52 1.000 Domainoid score I11466
eggNOG 1 0.900 - - E1_KOG3445
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41847
Inparanoid 1 1.050 115 1.000 Inparanoid score I4823
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48937
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004381
OrthoInspector 1 1.000 - - oto92948
orthoMCL 1 0.900 - - OOG6_103158
Panther 1 1.100 - - LDO PTHR21396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1159
SonicParanoid 1 1.000 - - X4758
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.